SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BS13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BS13
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily RING/U-box 1.22e-18
Family RING finger domain, C3HC4 0.0000121
Further Details:      
 
Domain Number 2 Region: 103-188
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.55e-16
Family Canonical RBD 0.0000113
Further Details:      
 
Weak hits

Sequence:  G5BS13
Domain Number - Region: 192-218
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0188
Family CCCH zinc finger 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BS13
Sequence length 579
Comment (tr|G5BS13|G5BS13_HETGA) CCR4-NOT transcription complex subunit 4 {ECO:0000313|EMBL:EHB12074.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03804 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPY
PEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRL
ADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV
VDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKL
LQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTP
SPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQT
SSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIE
KELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHSAASANANSLNSTFSVLPQRFPQFQ
QHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIP
IAENCYFQRTGTRKTQQGFKDDNTITISKKKVKEADYCL
Download sequence
Identical sequences G5BS13
HGL_H00000262563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]