SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BSS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BSS6
Domain Number 1 Region: 961-1030
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000346
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 
Domain Number 2 Region: 871-948
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000299
Family SAM (sterile alpha motif) domain 0.028
Further Details:      
 
Domain Number 3 Region: 1056-1101
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000557
Family SAM (sterile alpha motif) domain 0.044
Further Details:      
 
Domain Number 4 Region: 80-111,253-464
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000785
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 
Weak hits

Sequence:  G5BSS6
Domain Number - Region: 636-664
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BSS6
Sequence length 1210
Comment (tr|G5BSS6|G5BSS6_HETGA) Liprin-alpha-1 {ECO:0000313|EMBL:EHB12337.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_00309 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MMCEVMPTISEAEGPPGGSGSHGSGSPSQPDADSHFEQLMVSMLEERDRLLDTLRETQET
LALTQGKLHEVGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNN
TRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRE
RLRVALERCSLLEEELGATHKELMILKEQNNQKKTLTDGTLDVNHEQENTPSTNGKRSSD
GSLSHEEDLAKVIELQEVIDKQSREQSQMKERLAALSSHVSELEEDLDTARKDLIKSEEM
NTKLQREVREAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEIANKDSIHRQT
EDKNRQLQERLELAEQKLQQTLRKAESLPEVEAELAQRVAALSKAEERHGNIEERLRQME
AQLEEKNQELQRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLL
REVENAKKQLEETQHDKEQLVLNIEALRAELDQMRLRGASLHLGRPHLGSVPDFRLPMAD
GHTDAYSTSAVLRRPQKGRLAALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDVDV
SDGEDDRDTLLSSVDLLSPSGQADAQTLAMMLQEQLDAINKEIRLIQEEKENTEQRAEEI
ESRVGSGSLDNLGRFRSMSSIPPFPASSLAGSSPPGSGRSTPRRVPHSPAREVDRLGVMT
LSPASREEVRDDKTTIKCETSPPSSPRSLRLDRLHKGALHTVSHEDIRDMRNSTGSQDGP
VSNPSSSNSSQDSLHKAPKKKGIKSSIGRLFGKKEKGRPGQTGKESPGQAGVSETENSSQ
DALGLSKLGGQAEKNRKLQKKHELLEEARRQGLPFAQWDGPTVVVWLELWVGMPAWYVAA
CRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYG
DMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCG
IMCLRRLNYDRKELERKREESQNEIKGKYIMLDGYVLVWSNDRVIRWILSIGLKEYANNL
IESGVHGALLALDETFDFNALALLLQIPTQNTQARAVLEREFNNLLVMGTDRRFDEDDDK
SFRRAPSWRKKFRPKDIRGLAAGSAETLPANFRVTSSMSSPSMQPKKMQMDGSVSGTQRL
DSATVRTYSC
Download sequence
Identical sequences G5BSS6
HGL_H00000253925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]