SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BSU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BSU0
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.13e-39
Family Voltage-gated potassium channels 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BSU0
Sequence length 347
Comment (tr|G5BSU0|G5BSU0_HETGA) Potassium voltage-gated channel subfamily KQT member 1 {ECO:0000313|EMBL:EHB12351.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_00323 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSK
GQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSY
FVYLAEKDAVNESGLVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAIS
FFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYVRK
PTRSHMLLSPSPKPKKSAMVKKKKFKLDKDNGVSPGEKMLTVPHITCDPPEERRPDHFSV
DGYDSSVRKSPTLLEVSPAHFLRTNSFAEDLDLEGETLLAPITHVSQ
Download sequence
Identical sequences G5BSU0
HGL_H00000155840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]