SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BU89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BU89
Domain Number 1 Region: 231-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-81
Family Protein kinases, catalytic subunit 0.000000000199
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-39
Family SH2 domain 0.0000014
Further Details:      
 
Domain Number 3 Region: 54-172
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-23
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BU89
Sequence length 509
Comment (tr|G5BU89|G5BU89_HETGA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_09311 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLDGKATLLMRNGSEVRDPLVTYEDSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDKGGFYISPRITFPGLHELVRHYTNTPDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPPGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVQPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences G5BU89
HGL_H00000362663 XP_012929866.1.39548 XP_012929867.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]