SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BV98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BV98
Domain Number 1 Region: 246-393
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.61e-24
Family DnaQ-like 3'-5' exonuclease 0.0016
Further Details:      
 
Domain Number 2 Region: 518-691
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000412
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BV98
Sequence length 776
Comment (tr|G5BV98|G5BV98_HETGA) Putative RNA exonuclease NEF-sp {ECO:0000313|EMBL:EHB13209.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_04734 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MRLWRPRAETDPFMETEKEKTGEHPRKDRKRRQVSNQLVRATEPRRACWALKDLRPEAKK
ARLSAILFACNCQVTPGQLCELLKYAVLGRSIVPRPSWCQIFHQNHPNNVVVFILQGMSQ
LHFYKFYLEFELLWKIFRHKFCLPPQSSNFLADIIGLQKKTTGDLPKTSKGSLPSSSSKA
NINLHNDSIIQKHGSKKVGLSCCLLTMEEMKTFHFPLQGSPDCENFIPTKCNGSITDNSP
LFGLACEMCLTSKGRELTRISLVAEGGCCIMDELVKPDIRIVDYHTSFSGITKTIFNSVA
TKLKDVQRQLSALLPPDAVLVGHSLDLDLRALKMIHPYLIDTSLLYVREQGRRFKLKFLA
KAILGKDIQHPNTLQHDATEDARTALELAQYFLKYGPKKIAELNLESLGSHQELQAAGQK
PRNTTEIPHPNTSVLECVNLVGQKLLFVALEKGATELSSYGNCETIKCLSNKEVSDLLSL
SRPEWKFFPFSIVQFSFDPFTPVFTEEMSKRMKTKWREMSTVYAGPVSRTYNFRPLKRLL
KSFGPIQSMSFVLETYQLESNKEEILIFLQPHLCVQYEVLEAAQLAIESLNGIVVEGICI
KVQRPVTELTLDCDILMKELERDSENRDTIYLSGVSESFKDHIFHVSSHFPGLEAVILPK
DLESGKQKKFCFMKFKTFASAQRALNILTGKDWKLKGRGALTPRHLHKWLRGFSPESRWP
PGLRVMPPPSEQQALQTLKTDHPKVAAWYWGQKIGKLYQNMNPGTLCLILLPGCKR
Download sequence
Identical sequences G5BV98
HGL_M00000102130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]