SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BVD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5BVD9
Domain Number - Region: 42-79,116-133
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0439
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BVD9
Sequence length 261
Comment (tr|G5BVD9|G5BVD9_HETGA) Voltage-dependent calcium channel gamma-4 subunit {ECO:0000256|RuleBase:RU363085} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20860 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
GDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILL
LLGGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNH
YNYGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRY
RRRRSRSSSRSTEASPSRDASPVGLKITGGIPMGELSMYTLSREPLKVTTAASYSPDQEA
GFLQVHDFFQPDLKEGFHVSM
Download sequence
Identical sequences G5BVD9
HGL_H00000262138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]