SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BVK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BVK2
Domain Number 1 Region: 141-261
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000000254
Family Glyoxalase I (lactoylglutathione lyase) 0.016
Further Details:      
 
Domain Number 2 Region: 5-130
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000578
Family Glyoxalase I (lactoylglutathione lyase) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BVK2
Sequence length 298
Comment (tr|G5BVK2|G5BVK2_HETGA) Glyoxalase domain-containing protein 4 {ECO:0000313|EMBL:EHB13355.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_08221 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MASRRALHFVFKVGNRFQTTHFFRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGF
GTEDDHFVAELTYNYGIGDYKLGNDFLGITLASSQAVNNARKLQWPLSEVAEGVFEIEAP
GGYKFYLQNHILPQSDPVLKVTLAVSDLQKSLNYWSNLLGMKIYEQDEEKQRALLGYAEN
QCKLELQGIKGLVDHATAFGRIAFSCPQKELPDLEDLMRRENQKILMPLVSLDTPGKATV
QVVILADPDGHEICFVGDEAFRELSKIDPEGNKVLDDAMAADKSDEWFAKRNKVKASG
Download sequence
Identical sequences G5BVK2
HGL_H00000380548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]