SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BVN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BVN6
Domain Number 1 Region: 193-311
Classification Level Classification E-value
Superfamily ApaG-like 1.09e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 32-99,126-156
Classification Level Classification E-value
Superfamily YccV-like 0.00000000000863
Family YccV-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BVN6
Sequence length 324
Comment (tr|G5BVN6|G5BVN6_HETGA) Polymerase delta-interacting protein 2 {ECO:0000313|EMBL:EHB13302.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_08168 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MEKGIHLSRVNRAEGKVLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYD
RDVASGASEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDS
RALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKN
HPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHW
RIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHF
DVRIPPFSLESNKDEKTPPSGLHW
Download sequence
Identical sequences G5BVN6
HGL_M00000001127-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]