SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BWR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BWR8
Domain Number 1 Region: 163-265
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-22
Family Canonical RBD 0.00000283
Further Details:      
 
Domain Number 2 Region: 345-429,459-528
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.71e-19
Family Canonical RBD 0.0000601
Further Details:      
 
Domain Number 3 Region: 37-126
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-18
Family Canonical RBD 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BWR8
Sequence length 539
Comment (tr|G5BWR8|G5BWR8_HETGA) Regulator of differentiation 1 {ECO:0000313|EMBL:EHB13729.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_09556 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
QRGFDELLSCGVTNGSSTMNSSSPSTANGNDNKKFKGDRPPCSPSRVLHLRKIPCDVTEA
EVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPVTPHLRSQPVYIQYSNH
RELKTDNLPNQARAQAALQAVSAVQSGNLALHGAPSNEATVLPGQSPVLRIIIENLFYPV
TLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRI
DFSKLTSLNVKYNNDKSRDFTRLDLPSGDGQPSLEPPMAAAFGAPGIISSPYTGAAGFAP
AIGFPQATGLSVPAVPGALGPLTLTSSAITGRMAIPGASGVPGNSVLLVTNLNPDLITPH
GLFILFGVYGDVHRVKIMFNKKENALVQMADAHQAQLAMNHLSGQRLYGKVLRATLSKHQ
TVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKN
IFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI
Download sequence
Identical sequences G5BWR8
HGL_H00000414921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]