SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BYG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5BYG2
Domain Number - Region: 15-69
Classification Level Classification E-value
Superfamily Tropomyosin 0.0484
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BYG2
Sequence length 129
Comment (tr|G5BYG2|G5BYG2_HETGA) 26S protease regulatory subunit S10B {ECO:0000313|EMBL:EHB14323.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_02285 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVEPRDKALQDYRKKLLEHKETDGRLKELREQLKELIKQYEKSENDLKALQSVGQIVGEM
LKQLTEENFIVKATNGPRYIVDCRRQLDKTGMFAIRADHDFVVQEDFMKAVRKVADSKKL
ESKLDYKPV
Download sequence
Identical sequences G5BYG2
HGL_H00000401802-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]