SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BZI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BZI2
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000128
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BZI2
Sequence length 843
Comment (tr|G5BZI2|G5BZI2_HETGA) Nucleolar protein 8 {ECO:0000313|EMBL:EHB14693.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10936 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MKANRETKRLFVGGLSQAISKTDLQNQFSRFGEVSDVEIITRKDDQGNAQKVFAYVNIRV
EADLKKCMSILNKTKWKGGTLQIQLAKESFLHRLAQEREEAKAEKEKSTRGKTNLSEKMG
GVDFHMKAVPGTEVPGHKNWVVSKFGRILPVLHLKNQPRPKISFVISLSVLFTMPLLCSL
TVGNIMKYDPSKYCHNLKKIREDFTNSIPITSLTWELEGGNEPMSKKRQREFSDCHDPLK
KIMKVQKSQGSTVSPRTSWVMENNILPQQQAEQKAPPDSITLSKSHLVLDSDAQKLKNIL
CQTSNLEAVRKRNSMDDDDIDSEDELRMILAKEENLQRTSCSSDNEESERDEKYKAMMKN
CPRINLTLADLEQLAGSNMGVPENTESSGPQSTTSCKFDRASKSPKAPRSIYTGKQCICP
EEILASLLREENMHGKQTTGSAKIHKIGFDKDNCHGTQQREEASEEEESDSSSNTSNVKP
PKYCPGEDTQEGMADFLLSLSNSLSMDAKAKPVEDNQKRLAALEARQKAKEAQKKLVHNA
LANLDGPPQDKLTHIIFGSDSESEMEEASTQKQNLPGELVKESKGKASGKLFDGEDKESD
SEDDSDRFKIKPLMDLQLHFGSDDRFQMDSRFLESDSEEEQEEVNEKKTAEEEELATEKK
KALNVVQSVLNINLNNTTSKGPVAAKKFKDIIHYPTSHDHITYERTKDDKPKESKAKWKK
REEAEKLPEVSKDMYYNIATDLKEIFQDTKDTTEKEKDKPRHKGCGREKNEEVHSVVALM
SGAEQPSEFMFSFFDSDSKNVKEGSDLFWRGVGSNISKNSWEARTNSLLMDCRKKHKEAK
KES
Download sequence
Identical sequences G5BZI2
HGL_H00000351723-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]