SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5C1R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C1R4
Domain Number 1 Region: 63-142
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000244
Family Canonical RBD 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C1R4
Sequence length 143
Comment (tr|G5C1R4|G5C1R4_HETGA) U2 small nuclear ribonucleoprotein B {ECO:0000313|EMBL:EHB15475.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_07409 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTANKKPGQGTSTTDTQGNAT
PNPQVPDYPPKYILFLNNLPEETNEVMLFNQFPGFKEIHLVPGRHDIAFVEFENDGQAGA
ARDALQGFKITPSHAMKITYAKK
Download sequence
Identical sequences G5C1R4
HGL_H00000246071-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]