SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5C3P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C3P5
Domain Number 1 Region: 156-251
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.48e-21
Family Middle domain of MutM-like DNA repair proteins 0.012
Further Details:      
 
Domain Number 2 Region: 63-131
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000144
Family N-terminal domain of MutM-like DNA repair proteins 0.012
Further Details:      
 
Domain Number 3 Region: 319-346
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000107
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5C3P5
Sequence length 606
Comment (tr|G5C3P5|G5C3P5_HETGA) Endonuclease VIII-like 3 {ECO:0000313|EMBL:EHB16156.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_02336 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVEGPGCTLNGEKIRALVHPGQAVTDVRGRALQSLERHSPPPAASVTEVSFQAAALKDSK
DSSRNFLRLFNGYVYSGVKTLGKELFMFFGPKALRIHFGMKGSILINPLAYKNKNGVSPV
FELQLTNDLICFFDSSVELRNSMESQQRIRMMEELDVCSPKFSFLRAESEVKKQKGRMLC
DVLLDQKVLPGVGNIIKNEALFDSGLHPAVKIFQLTDEQTHHLVKMIRDFSILFYRCCKT
GSAISKHYKVYKRPNCGQCHCKIIVCRLGENNRMTYFCSHCQKENPQHIDICKLPSRNTI
INWTSSRGNRLIDSVGRKSEEQWTCLVCTLVNKPSAETCDACLTSKPDSVLETQENSIVF
HNLVKYPCNSFGKAHTEVKINRKTVFGTTTLVLTDFTSKSSTLKRKESQIQTPDGEFQNS
LPTNVCFSDTRHPSKERTNYITQVSNKVNISPTVCSQSELFSSVHKKLKTTLYSMPDLKS
CKTGFSNSEPQLSVADSPCTLNAGSPRCSKHSRLCVVRVVRKDGENKGRRFYACPLPREA
QCGFFKWADLSFPFCNHGKRSIMRTVLKIGPNNGKNFFVCPFEKEKQCNFFQWAENGPGI
KIIPGC
Download sequence
Identical sequences G5C3P5
HGL_H00000264596 XP_004853020.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]