SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5C492 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C492
Domain Number 1 Region: 54-132
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000136
Family Canonical RBD 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5C492
Sequence length 209
Comment (tr|G5C492|G5C492_HETGA) Nucleoporin NUP53 {ECO:0000313|EMBL:EHB16353.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_01658 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MQSPLVGVTTTTPGSGQSVFSPTNIGQSRKMTLSPAQLDPFYTQGDSLTSEDHIDGTRVT
VIWFPQASASYILLQFPQYGNILKHVMSSTGNWMHSRYQSKLQAQKALNKDGRIFAESIM
IGVKPCIDKSVMENSDRGALSSSSLAFTPPIKTLGTPTQPRSTPRISTMKPLATAYNAST
SDYQFISDRHTPKKDESLVSKAMEYMFGW
Download sequence
Identical sequences G5C492
HGL_H00000295119-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]