SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5C5S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C5S3
Domain Number 1 Region: 1035-1345
Classification Level Classification E-value
Superfamily RNI-like 1.09e-42
Family 28-residue LRR 0.008
Further Details:      
 
Domain Number 2 Region: 519-635
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.86e-32
Family Ankyrin repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 28-62,164-235,310-381
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000209
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 
Domain Number 4 Region: 9-141
Classification Level Classification E-value
Superfamily TPR-like 0.000000000768
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C5S3
Sequence length 1363
Comment (tr|G5C5S3|G5C5S3_HETGA) NF-kappa-B inhibitor-like protein 2 {ECO:0000313|EMBL:EHB16884.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_19231 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MILERELRQLNKAKARAKRSGQPREEAAFCHQLGELLAGHGRYAEALEEHREELRLLEGT
QDPLGCAVAHRKIGERLAEMEDYSAALRHQHCHLELAGSLSNHTEMQRAWATIGRTHLDI
YDHCQSREALVQAQAAFEKSLAIVDEKLEGTLTQRELSEMRTRLYLNLGLTFESLQQTAL
CNAYFKKSIFLSEHNHLYEDLYRARYNLGTIHWRAGQHSQAMRCLEGARECARAMKKRFM
ESECCVVVSQVLQDLGDFLAAKRALKKAYKLGSQKPAQRAAVCQSLKYVLAVVQLQQRLE
EAEGSDLQGAMAFCEQLGDLFSKAGDFPKAAEAYQRQLHFAERLNRPDSELAIIHVSLAT
TLGDMKDYRQAVHHYEEELRLCKGNSLEEAKTWLNIALSRDEAGDAYELLAPCFQTALNC
AQQAQRPQLQRQVLQHLHTVQLRLQPQDAPGTETKLEELSVGKEEEEEEEEEVEEEAIEA
LETIEPELSESEDDGDDPSREPEEDEERQGCLGRRKVNKWNRRNDMGETLLHRACIEGRL
RRVQDLVKQGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGASVDDPGGQGCEGITPL
HDALNCGHFEVAELLIDQGASVTLQTKKGHSPLETLQQWVKLYYKDLDLETQQKAAAMER
RLKAASSGPGKYTPAPRTVLSNHLFDPETSPPLNPCPEPLASAAHARISPKRTASAVARP
RRSRHRLASSSSSSEGEDSVSPHGPSQKRLKCSALAQQDEAWTSGPASTREASTSRAAYQ
AAIRGVGSAQSRCRGPGLLWGTSEGPVPQAALIPEEEYLAGNWLEMDEPLMHSRPSHIAC
PQGSGDSGSSPSESDKEHPIRPRAQAKQTRLTCLKSWSTLDKVGGMAAEPPGDPIMPKTS
GASRESPDGGQSTSLVQAPPIRVRVRVQDHLFLIPVPHSSEAHSVAWLAEQAAQRYYQTC
GLLPRLTLQKEGALLAPQDPILDVLQSNDEVLAEVTSWDLPPVTDRYRRACQSLGQGEHL
QVLQAMEHQGSGPSFSTCSLALHQAHLTPLLRALKMHTGLRELRLAGNRLGDGCATELLA
ALGTMPCLVLLDLSSNHLGQEGLRQLAGGPTGQATLQNLEELDLSMNPLGDSCGQALASI
LRACPFLSTLRLQACGFGPNFFLSHQATLGPAFQDAECLKTLSLSYNPLGTSALARTLQS
LPTGTLLRLELSSVAAGKSDLGLIEPLVRYLTKEGCVLTHLTLSSNYLSDKTVGELSRCL
PLCPSLISLDLSANPKISRTSLEELLSALQERSQGLSFLGLSGCAIQGPLGPGLWDKITT
QLQELRLCSRHLCPEDRDALRQLLRGQGACLLDRGPKLFFQRL
Download sequence
Identical sequences G5C5S3
HGL_H00000386239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]