SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5C636 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C636
Domain Number 1 Region: 422-825
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.82e-134
Family Ankyrin repeat 0.000000000000437
Further Details:      
 
Domain Number 2 Region: 66-356,383-440
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.1e-104
Family Ankyrin repeat 0.000000377
Further Details:      
 
Domain Number 3 Region: 1412-1496
Classification Level Classification E-value
Superfamily DEATH domain 3.36e-22
Family DEATH domain, DD 0.0032
Further Details:      
 
Domain Number 4 Region: 5-97
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.22e-19
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C636
Sequence length 1965
Comment (tr|G5C636|G5C636_HETGA) Ankyrin-1 {ECO:0000313|EMBL:EHB16997.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_09783 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
ADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEI
ILETTTKKGNTALHIAALAGQNEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKF
LLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTA
AVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGASVNFTPKNGITPLHIASRR
GNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPI
HMAAQGDHLDCVRLLLQYNAEIDDMTLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRAL
GLFASPQVPLGYYVTLKSVSLRVGLQNGFTPLHIACKKNHIRVMELLLKTGASIEAVTES
GLTPLHVASFMGHLPIVKNLLQRGASPNASNVKVETPLHMAARAGHTEVAKYLLQNKAKV
NAKAKDDQTPLHCAARVGHTNMAKLLLESNANPNLATTAGHTPLHIAAREGHVDTALALL
EKEASQACMTKKGFTPLHVAAKYGKARVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLD
IVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQMEVARSLLQYGGSANAESVQGVTPLHLAS
QEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVTVDSTTRMGYT
PLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLRSGASPNEV
SSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETVDEILDVSEDEGED
LVGSKAERQDSRDMDEERELLDFVPKLDQVVESPAIPRIPCVTPETVLIRSEEPEQASKE
YDEDSLIPSSPATETSDNISPVASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTC
AAPTRITCRLVKPQKLSTPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGD
RELVVLRSENGSVWKEHKSRYGESSLDQILSGMDEELGSLEELEKKRVCRIITTDFPLYF
VIMSRLCQDFDTIGPEGGSLKSKLVPLVQATFPENAVTKKVKLALQAQPVPDELVTKLLG
NQATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTDNPRDNGEGDTTSLRLLCSVIGGTDQA
QWEDITGTTKLVYANECANFTTNVSARFWLSDCPRTAEAVNFSTLLYKELTAVPYMAKFV
IFAKMNDPREGRLRCYCMTDDKVDKTLEQHENFVEVARSRDIEVLEGMPLFAELSGNLVP
VRKAAQQRSFQFQSFRENRLAIPVKVRDSSREPAGFLSFLRKAMKYEDTQHILCHLNVTM
PACTKGTGAEDRRRTLTPLALRYSGLSFPSGTDRADLKVAVITEHLGLSWAELARELQFS
VEEINRIRVENPNSLWEQSAALLNLWAAQEGENAKMENLYAALRNIDRSEIVNMLEGSGR
QSRNLKPDRRQADQDYSLSPSQMNGYSSLQDELLSPASLHYTLPSPLHADQYWNEVAVID
AIPLAATEHDAMLEMSDMQVWSSGLTPSLVTAEDSSLECSKAEDSDVTQEWKLEGALSEE
SRGPELGSLDLVEDDTVDSDATNGHADLLGQEEGQRSEEKRQEDSAGAGQDSENEVSLVA
GQQRVQVRTTDSPSMSRVLERNQDRPQDWDFEGSIAFYLQDAARGSWPEEATQGPHSFQT
TTSTIQGSEHDTVLVSVGEHMWTAQPETQSSQAGREGGIRAARSTFLQVEQLLVTLVLLG
FFLVSCQNVMHIVKGSLCFMLKHIHQELDKELGEVEGLSDDEETISTRVVRRRVFLKGNE
LQNIPGEQVTEEQFTDEQGNFVTKKTIRKVVRQIDSSGADDTQEHEEVIVGGPLEKDTSV
LETDPDFITKLDKVELRGSSLQPDLLEGRKGAQIVKRASLKRGKQ
Download sequence
Identical sequences G5C636
HGL_H00000407057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]