SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5C708 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C708
Domain Number 1 Region: 8-157
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.11e-33
Family Canonical RBD 0.0041
Further Details:      
 
Domain Number 2 Region: 231-307,362-440
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.36e-19
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C708
Sequence length 449
Comment (tr|G5C708|G5C708_HETGA) RNA-binding protein 45 {ECO:0000313|EMBL:EHB17319.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_13562 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
SRIFLVISKYTPEAVLWERFSPFGEIQDIWVVRDKHTKESKGIAFIKFARSSQACRAMEE
MHGQCLEPNNTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEEDLREKFKVYGD
IEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIENCDRSFRAILAEPKNKPSESSEQDYY
NNMRQEALGHEPRINMFPFDQQSEFPNFDKNDNRGHEAISKRLSVISRVPFTEEQLFSIF
DIVPGLEYCEVQRDPYSNYGHGVVQYFNVASAIYAKYKLHGFQYPPGNRIGVSFIDDGSN
ATDLLRKMATQMVAAQLASVVWNNPSQQQFLQFGGSSGSQLPQIQTDVILPSCKKKADPE
TPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIEVYLVSGKNVGYAKFADRMSANDAIATL
HGKILNGVRLKVMLADSPREESNKRQRTY
Download sequence
Identical sequences G5C708
HGL_H00000393937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]