SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5CA27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5CA27
Domain Number 1 Region: 184-210,240-344,379-488,517-627
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.55e-53
Family (Uracil-5-)-methyltransferase 0.0044
Further Details:      
 
Domain Number 2 Region: 81-168
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000326
Family Canonical RBD 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5CA27
Sequence length 664
Comment (tr|G5CA27|G5CA27_HETGA) tRNA (Uracil-5-)-methyltransferase-like protein A {ECO:0000313|EMBL:EHB18388.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_11145 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MMSEKMDNEVKRDARTTEVGMEWEENPEPMKDCGQESCSALGNPAAPTAQEEQEKEGPGA
SVEPGPQPGLYSYIRDDLFTSEIFKLELQNLPRHASFSDVRRFLGRFGLQPHKTKLFGQP
PCAFVTFRSAAERDKALRVLHGALWKGRPLSVRLARPKADPMARRRQQEGEGEPLATQIA
DVVTPLWTVPYAEQLERKRLECEQVLQRLAKEIGSTNRALLPWLLTQRHKHNKACCPLEG
VRPSPQQTEYRNKCEFLVGIGVDGKDNTVGCRLGKYKGGTCAVAAPFDTVHIPEATKQVV
KAFQEFIRSTPYSAYDPETYAGHWKQLTVRTSRRGQAMAIAYFHPQKLSPEELTGLKTSL
AQHFMEGPGRASGVTCLYFVKEGQRKTPSQEGLPLEHVAGDRCIQEDLLGLTFQISPHAF
FQVNTPGAEVLYTVIQDWAQLDKGSTVLDVCCGTGTIGLALAQKVKKVIGIELSQEAVED
ARVNAHANGEYLQAMGRAGPEREGPQGPLIAMVLPPELNNVEFHCGRAEDLVPALVSRLV
SQQLVAILDPPRAGLHSKVILAVRRAENLKRLLYVSCNPRAAMGNFVDLCRAPSNRVKGT
PFRPVKAMAVDLFPQTPHCEMLILFERMEYPNGTRTLEHQDPPAQPPPGHPDDIPQETRV
PLSS
Download sequence
Identical sequences G5CA27
HGL_H00000395738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]