SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5CA50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5CA50
Domain Number 1 Region: 95-333
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-17
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5CA50
Sequence length 504
Comment (tr|G5CA50|G5CA50_HETGA) Cation channel sperm-associated protein 2 {ECO:0000313|EMBL:EHB18411.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_07422 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
LLFSSQTAMDHHARHMHLPRADAIRSRRIDLELFQASGQPVPLFTTREILDPSLQKPLRL
RDQHQQVRFSTKARHLGRVSHAQRLLCRFHVRHNPWFKNLITFLIILNAIVRMITIELLD
STNNSLWPLKLSLEVAVWFILPVFTVEILLKWVASFSLFWKNAWNVFDFTVTLLPLLYEI
LVLGGVTGHPVWLELLSICSVMRCFRLYAQFHQVRVIILALVRTFKSIRFHFMLLLLLFY
IFAVAGVYFFKDYTRSTRQDLVYKEAFLGLPYSLITVFILFTMDHWNALLRDIWKVPEVS
SVISSTYIILWVLLGSIILRNVIISTMANNFRDIRDELDKEMAHLAAQHKADVLKLQILR
RRQNLSFTTLRSSHSKINPREVRRHRMSLDFQEASSEKEFKNSAVEKDLTVSSKLTKESL
IKREESSSSSTTSSSSEYGDTQEAFLPTDQLDWENLVHQNLPELLEMDRDEYTLWPRNLL
LRYLELLEELQYNLEERKELQQLA
Download sequence
Identical sequences G5CA50
HGL_H00000371180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]