SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5SWL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5SWL1
Domain Number 1 Region: 536-968
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.89e-34
Family alpha-mannosidase, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 121-318,349-429
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000593
Family alpha-mannosidase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5SWL1
Sequence length 969
Comment (tr|G5SWL1|G5SWL1_9BACT) Glycosyl hydrolase family 38 protein {ECO:0000313|EMBL:EHG98242.1} KW=Complete proteome OX=762968 OS=Paraprevotella clara YIT 11840. GN=HMPREF9441_03784 OC=Paraprevotella.
Sequence
MKRIFFCGMLAVLAAGQASADVVPEQVSCVVKPLYGYRQDRSPGRIVAVRLKGPELKGEV
RVDVAYKKLKETSTFRVDAKDSAEVEIMLPSALPMDKAASVSLTVCGTEKKVKTKVTVEP
MRHWTVYLYNHSHVDIGYTNTHKNVEMLHKTNVWEGMKLARETAGHVDGARFVWNPEVTW
PIERLWISEPEKRDEVIAAIRRGDLCVDASYVNLNTSICSDEELFHVFKFSRELQRLSGV
PADVFQQFDIPGISWGLVPVMAQEGIKYVISWPNTDRGGNAHSRNIDGMPFWWVGPDGHS
KVLFLQPGKYSNSGSMDKGNTTGRPWFGQRDPRKVPARIRMGSANVDFTGKLVELERDHY
PLDFIVLSWTLWDNSPVDADVPYAVNEWNKKYAYPKIVISGGHEIMARLEKDYGDRLPTV
TGDYTEYWTDGLGTAARLTAINRRNKERITQAETVWSMLAGGACAPRDDFDEGWRYIMMG
SEHTWDFENPWEPYFHEAIGKVKQSYFQEAEARSMALLDEALGLATDKSNGALGPREGPS
NGGIAVLNTQSWPHGGLVTLTASESQKGNKVVDDEGNAVPSQRLSTGELVFWASDVPALG
SRHYRVVEGDAMPSDACKVEGYTLDNGCVRVTIDGKTGNISALTRAGEDYNYIDVSVDGG
ANSCSWLPANENKPEADKVQAVTVTEQGGLVVELKVESTMKGCRSVTRTVRLVAGQPWVE
TTNVVDKLPLLDKDGIHFGFGFNVPQGVTKVDIPWGVMEMEKDQWAQANRNWIALQRWLD
VSNDTHGVTWCALDAPLFEYGDRTANISLGWGGQGPWLTQLESSSTVYSWAMNNHWHTNF
PLTQDGPVAFRYRIHPHGGYDAVAANRFGLEQAQPLVHVTADKNPDVKPVVAVDNRAVYV
TVLKSTGKDDEMIVRLRSVSDKEETVALDFPARRPSSVSLCPLEEQPGQAVEGTLTMRPY
GMATLKLAF
Download sequence
Identical sequences G5SWL1
WP_008623025.1.53855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]