SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7DFZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7DFZ5
Domain Number 1 Region: 17-395
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.49e-96
Family AAT-like 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7DFZ5
Sequence length 395
Comment (tr|G7DFZ5|G7DFZ5_BRAJP) Aspartate transaminase {ECO:0000313|EMBL:BAL10769.1} KW=Complete proteome OX=1037409 OS=Bradyrhizobium japonicum USDA 6. GN=BJ6T_55140 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MHDATLRNRVGQWLEPSRRSDVPPFMVMDVMAAAARIEAAGGHVIHMEVGQPATGAPKTA
IAAAHAALEAGRIDYTSALGIPSLRERIARHYRDAYGCDVNPERVVVTTGSSGGFILAFL
SMFAPGDRVAVTVPGYPPYRHILTALGCEPVLIETSNDTRHALTGEALLAAHRKAPLKGV
LVGSPANPTGTMMPREALAGLIAAAEDAGIRFISDEIYHGLDYAFPAATAAALSEHALVI
NSFSKYFCMTGWRVGWMVVPEILVRPIERLQQNLSISVPSLSQIAAEAAFDGAAEMEEIK
HGYQENRRILIEGLPKAGLNKFLPADGAFYLYADVSDFTSDSFEFAKQMLEQAHVAATPG
LDFDPIHGRSFIRLSYARSAAEMREAVDRIAHWLK
Download sequence
Identical sequences G7DFZ5
WP_014495588.1.18950 WP_014495588.1.35620 WP_014495588.1.77977 WP_014495588.1.97209 gi|384219191|ref|YP_005610357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]