SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7DN58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7DN58
Domain Number 1 Region: 4-368
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.4e-106
Family Cystathionine synthase-like 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7DN58
Sequence length 400
Comment (tr|G7DN58|G7DN58_BRAJP) Uncharacterized protein {ECO:0000313|EMBL:BAL08938.1} KW=Complete proteome OX=1037409 OS=Bradyrhizobium japonicum USDA 6. GN=BJ6T_36640 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MHQGRHFLQIPGPSPVPERVLRAMDMPVIDHRSAEFGELGRAVLEGSQTIFQTAGPVVIF
PSSGTGAWEAAIVNTLSPGDKVLMVETGHFATLWRQMAGRFGIEVDFVPGDWRRGADPAL
IEAKLTDDKARAIKAVMVVHNETSTGATSRIAEIRAAIDRTAHPALLMVDTISSLGSVDY
RHDEWKVDVSVSCSQKGFMLPPGLGFNAISEKARAAAKTNKMPRSYFDWEEMLKPNANGF
FPYTPATNLLYGLREAIAMLLEEGLDNVFARHQRLAAATRAAVSHWGLEILCQEPSEFSP
VLTAVLMPPGHDADQFRKIVLDNYNMSLGSGLSKVAGKVFRIGHLGECNALTLLGALTGV
EMGLSVAGVPHRSGGVDAAMKLLEQRPQGNASPHLKVVGT
Download sequence
Identical sequences G7DN58
gi|384217360|ref|YP_005608526.1| WP_014493792.1.18950 WP_014493792.1.35620 WP_014493792.1.77977 WP_014493792.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]