SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7DRJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7DRJ1
Domain Number 1 Region: 2-320
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.37e-46
Family AAT-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7DRJ1
Sequence length 321
Comment (tr|G7DRJ1|G7DRJ1_BRAJP) Cobalamin biosynthetic protein {ECO:0000313|EMBL:BAL11741.1} KW=Complete proteome OX=1037409 OS=Bradyrhizobium japonicum USDA 6. GN=BJ6T_64920 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MREHGGNLDLAQQRFGGRAEDWIDLSTGINRLPYPVGEVSARAWNALPSRAEIESLHQAA
QHAYRTSAPIVAMGGAQAAIQLLPQLAPRGRARILAPTYNEYAGVLSTAGWDVQEVGELD
ALAGADLAVVVNPNNPDGRRFAPQDLLALLPRVGRLVIDESFADAAPLLSLASEADRPGL
LVLRSFGKFYGLAGLRLGFALGHAADIAKLGAASGPWPVSGAAIAIGCRALRDDHWAEAT
SARLARDCARLDDIVRSLGWRLVGGAPLFRLYETPDALAAQEKLARSQIWSRVFAREPAW
LRLGLPGSEAEWTRLAEALAR
Download sequence
Identical sequences G7DRJ1
WP_014496551.1.18950 WP_014496551.1.35620 WP_014496551.1.77977 WP_014496551.1.97209 gi|384220163|ref|YP_005611329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]