SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7ICR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7ICR2
Domain Number 1 Region: 2986-3274
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-120
Family BEACH domain 0.0000000214
Further Details:      
 
Domain Number 2 Region: 3328-3529,3559-3609
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.68e-31
Family WD40-repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 2794-2837,2908-2960
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-16
Family PreBEACH PH-like domain 0.037
Further Details:      
 
Domain Number 4 Region: 1134-1281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000106
Family Glycosyl hydrolases family 16 0.068
Further Details:      
 
Domain Number 5 Region: 495-634,687-726,772-839,929-1016
Classification Level Classification E-value
Superfamily ARM repeat 0.00000146
Family HspBP1 domain 0.086
Further Details:      
 
Weak hits

Sequence:  G7ICR2
Domain Number - Region: 1410-1467,1591-1667,1715-1779
Classification Level Classification E-value
Superfamily ARM repeat 0.0281
Family HspBP1 domain 0.043
Further Details:      
 
Domain Number - Region: 172-198,232-353
Classification Level Classification E-value
Superfamily ARM repeat 0.0748
Family Regulatory subunit H of the V-type ATPase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7ICR2
Sequence length 3612
Comment (tr|G7ICR2|G7ICR2_MEDTR) Beige/BEACH and WD40 domain protein {ECO:0000313|EMBL:AES60820.2} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_1g071260 OC=Trifolieae; Medicago.
Sequence
MKWVNLLKDFKEKVGFTQSSSASSQPPSASTSAAVSPSRGDNINNNAFFSASQSSSSSPN
RDRHELELDFKRFWEEFRSSSSEKEKEAALNWSIDAFCRLVKQQANVAQLITMLVETHIF
SFVVGRAFVTDIEKLKISSKTRSLDVAQVLKFFSEVTKDDISPGANLLTSVGILVSGPID
KQSLLDSGIFCCLIHVLNALLDPDATIQRPNSTTDHEERLVLQKEYNVGVGQNRRLEVEG
SVVHIMKALASHPSAAQSLIEDDSLQLLFQMVAKGSLIVFSRYKEGLIPLHNIQLHRHAM
QILGLLLVNDNGSTAKYIRKHLLIKVLLLAVKDFDPDCGDSAYTVGIVDLLLKCVELSYR
AEAGGVRLREDIHNAHGYQFLVQFTLTLSNMTESQGFQSIPFDEDKDVASDGSQNSRGQN
FNEQEKSSIQYLSPTLSRLLDVLVSLAQTGLDESPPTYGGKSSKSSQSKGGGHSKSRTLS
SDWLGDELWEKDNDKIKDLEAVQMLQDILLKASNQELQAEVLNRLFKIFSGHLENYKLCQ
QLRTVPLLILNMAGFPSSLQEIILKILEYAVTVVNCVPEQELLSLCCLLQQPITSELKQT
ILSFFVKLLSFDQQYKKVLREVGVLEVMLDDLKQHRILGPDQQNVNLNLPERKTSSSSFK
KHMGNKDVIITSPKLMESGSGKFPIFDVEATIGIAWDCMVSLLKKAEANQASFRSATGVT
AMLPFLVSDIHRPGVLRILSCLIIEDTSQAHPEELGVLVEILKSGMVTSASGSQYRLSHD
AKCDTMGALWRILGVNNSAQKVFGEATGFSLLLTTLHGFQSDGGDLDQSSLSFYVKVFTY
LLRVVTAGVADNSVNRMKLHAIISSQTFFDLLCESGLLCVEHEKQVIQLMLELALEIVIP
PFLASEGLIKPNAIENESSQNLLLTPSGPIDPDKERVYNAGAVKILIRSLLMFTPMVQLK
LLDLIEKLARAGPFNLESLTSTGCVELLLDTIHPFLSGSSSLLSRALKIVEVLGSYRLSA
SELRTLIRYVMQMRLKNSGHIIVEMMEKLILMQDMSSENISLAPFMEMDMSKIGHAAIQV
SLGERSWPPAAGYSFVCWFQFQNFLKSPSKDTDPSKVVPSKKRSGPNGLQERQILRIFSV
GATNNDDATYAELYLQEDGILTLATSNSSVLSFSGLELEEGRWHHLAVIHSKPNALAGLF
QASVAYVYLNGKLRHTGKLGYSPSPPGKPLQVTIGTSVNNTRVSDLAWKLRSCYLFEEVL
TPGCICFMYILGRGYRGLFQDTDLLQFVPNQACGGGSMAILDSLDADLTLVATGQRVDAT
SKQGDLKADGSGIVWDLERLGNLSLQLSGKKLIFAFDGTSTEFIRSSGSFSVLNLVDPMS
AAASPIGGIPRFGRLCGDTYICKQDVIGETIRPIGGMELVLALIEAAETRDMLHMALTLL
ACALHQNHQNLKDMQTYRGYHLLALFLRRRMSLFDMQSLEIFFQIAACEASFSEPKKFEI
TQINLSPAVSPQEASLEDNFLSKFHDENSSAGSHGDMDDFSVPKDSFSHISELENTDIPA
ETSNCIVLSNADMVEHVLLDWTLWVTASVSIQIALLGFLENLVSMHWYRNHNLTILRRIN
LVQHLLVTLQRGDVEVPVLEKLVVLLGVILEDGFLSSELENVVRFVIMTFDPPGLTPQRP
IMRESMGKHVIVRNMLLEMLIDLQVTIKSEELLEQWHKVVSSKLITYFLDEAVHPTSMRW
VMTLLGVCITSSPTFALKFRTGGGYQGLVRVLPSFYDSPDIYYILFCLMFGKPVYPRLPE
VRMLDFHALMPNDGNYTELKFVELLDSVVAMAKTTFDRVSMQSMLAHQTGNLSQAGASLV
AELVEGNSDMAGELQGEALVHKTYAARLMGGEASAPAAATSVLRFMVDLAKMCPPFTAVC
RRPEFLESCIDLYFSCARAAHAVKIAKELSAVTEEKTFNDGDDTCSSQNTFSSLPLDQDQ
SVKTSISVGSFHQGQVSSSSDDMAAPANSKVGEKSDNNVTVTAPDSNVTVIEPESKKSVH
EDTQTVQSLDGDNADQGSVSSSAHEFSFHSIKGNLDIQLPTDSHSSASFAVLDSPVFSEK
SNSRTPLTPSSSPVVALTSWLGSSSHNEAKSPLTPTPSFNSSMSAGDFDSTSNLKSNFQE
PSAANAYFTVTSKLLLDIDDSGYGGGPCSAGATAVLDFIAEVLSDFVTEQVKASQLIEII
LESVPLYIDSESVLVFQGLCLGRFINFLERRLLRDDEEDEKKLDKIRWSSNLDALCWLIV
DRVYMGAFPQPSGVLKTLEFLLSMLQLANKDGRIEDAAPSGKRLLSIARGSKQLEAYIHS
ILKNTNRMILYCFLPNFLVSIGEDDLLSRLGFLGEPKKRLSSTSSQDDSVIDIYTVLQLL
VAHKRIIFCPSNTDTDLNCCLCVNLVSLLCDKRHNVQNIAIDLFKYLLVHRRAALEDLLV
SKPNQGKQLDVLHGGFDKLLTRSLSEFSEWYQNTEQIVNKVLEQCACIMWVQYIAGSSKF
PGVRIKGIEGRRKREMGKKSREAAKLDLRHWEQVNERRYALDLVRDAMSTELRVVRQDKY
GWILHAESEWQCHLQQLVHERGIFPLSKSSLTEEPEWQLCPIEGPYRMRKKLECCKLKID
TIQNILDGQFELEKPELSKGIVDNGPDASDSKSYFPLLTDGGKQNSSDGELYGPFFDDKL
ESVKDAVSEKNEWNEDKASSMNEASLHSALEHGAKSSVVSVPIEESTLGRSDMGSPRQSS
SVKVDDFKIADDKSDKEVHDNGEYLIRPFLEPLEKIRFKYNCERVVGLDKHDGIFLIGEF
CLYVIENFYIDDSGCFWEKECEDELSVIDQALGVKKDANGSLDFQSKSTLSWSTTAKSLV
GGRAWAYSGGAWGKEKVHTSGNLPHPWRMWKLDSVHEILKRDYQLRPVAVEIFSMDGCND
LLVFHKKEREEVFKNLVAMNLPRNSMLDTTISGSSKQESNEGSRLFKVMAKSFSKRWQNG
EISNFQYLMHLNTLAGRGYSDLTQYPVFPWVLADYESENLDLSDPKTFRRLDKPMGCQTP
EGEEEFIKRYDSWDDPEVPKFHYGSHYSSAGIVLFYLLRLPPFSIENQKLQGGQFDHADR
LFNSVRDTWLSAAGKGNTSDVKELIPEFFYMPEFLDNQFNLDLGEKQSGEKVGDVMLPPW
AKGSAREFISKHREALESDFVSENLHHWIDLIFGYKQRGKAAEESVNVFYHYTYEGSVDI
DSVTDPAMKASILAQINHFGQTPKQLFLKAHVKRRTDRKLPPHPLKHSSHLVPHEIRKSS
SPITQIVTLYDKILITGINNLLKPRTYTKYVAWGFPDRSLRFLSYEQDRLISTHENLHGG
HQIQCAGVSHDGQILVTGADDGLVNVWRVSKFGPRALRRLKLEKPLCGHTTKVTCLQVCQ
PYMLIVSGSDDCTVIIWDLSSMAFVRQLPEFPAPVSAIFVNDLTGEIVTAAGILLAVWSI
NGDCLSMINTSQLPSDSILSVTSSRFSDWQETKWYATGHQSGAVKVWQMVHCSDPDSSLS
KSGASGFRVLNLGAKEPEYRLILRKVLKFHKHPVTALHLTIDLKQLLSGDSGGHLLSWTL
PDESLRGSLNQG
Download sequence
Identical sequences G7ICR2
Medtr1g071260.1 XP_003590569.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]