SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7J4K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7J4K4
Domain Number 1 Region: 2592-2875
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-123
Family BEACH domain 0.0000000146
Further Details:      
 
Domain Number 2 Region: 2984-3245
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.47e-41
Family WD40-repeat 0.0066
Further Details:      
 
Domain Number 3 Region: 2408-2460,2509-2560
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-19
Family PreBEACH PH-like domain 0.0061
Further Details:      
 
Domain Number 4 Region: 1083-1274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.27e-19
Family Pentraxin (pentaxin) 0.086
Further Details:      
 
Weak hits

Sequence:  G7J4K4
Domain Number - Region: 970-1066
Classification Level Classification E-value
Superfamily ARM repeat 0.00535
Family HspBP1 domain 0.044
Further Details:      
 
Domain Number - Region: 1398-1475,1570-1649,1726-1827
Classification Level Classification E-value
Superfamily ARM repeat 0.00543
Family Armadillo repeat 0.068
Further Details:      
 
Domain Number - Region: 284-413
Classification Level Classification E-value
Superfamily ARM repeat 0.0153
Family Armadillo repeat 0.062
Further Details:      
 
Domain Number - Region: 662-691,742-761,815-1044
Classification Level Classification E-value
Superfamily ARM repeat 0.0164
Family HspBP1 domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7J4K4
Sequence length 3254
Comment (tr|G7J4K4|G7J4K4_MEDTR) BEACH domain LvsC-like protein, putative {ECO:0000313|EMBL:AES73140.2} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_3g100060 OC=Trifolieae; Medicago.
Sequence
MNIVKGVADLIRRTSSGHSGESSSFHAQKFSPPGPKIRFSDAGDEAIVNTLWERYQKNDD
KVEKKRLLHVFIKQFVVVYKDWEPINSGILLESASVEKFSSADDVVVGCSAGHPVEVIRV
LVDEVTQLSSLVTELSTSILQSTELSGAATKSYITSEGFLILDALKIIARSLYNCRVFGY
YGGIQKLTALMKGAVVQLKTISGALSADESLSDFVLEKIKLLQQILIYVVSIFYVFIDLG
SNIDKKDELFCSLVGFISRVDAAISSSNSSKVLSTEARLHWRQKAIVSVMEAGGLNWLVE
LLRLCRRFSLKELLMDDSLQYLSLKILSLALSANPRGQNHFKSIGGLEVLLDSLGFPSNY
ATTYRKFVLTNGFRDDQPLQKIFQLHILALEVLREAVFGNMNNLQFLCENGRIHKFANSF
CSPAFVLQDLRQGEDFAGQQAVSVPGLDIHENKNNMKFDPAMASAGLTPDASFSHFWNDY
VLMLSRSLCSFLIVPGASKSLNIQLSSGRLALPVSSSYCELSIKWVIRVLFTLFPCIKAC
SNQNDLPSYLRVFVTILQNTVLNAFKNLLSTSPMSLENFREEGIWDLIFSENFFYFESGL
EEIGRQVFAYNEKSELLSASSSTVDKPEVNGVRSLQMEIMSFVEFAATSNGNTHNMTELS
ALLDALEHSACNPEIAGLLVRSLVRILQLSPEKTITSCKTLNAVSRVLQVACVQAQECKR
SGSMDPSSVNSGLEVLESVPDQPNCNSPETVQNWFGCMKMCMEFFTKFFASAEDTKSFIL
HSFASIDCLFDLFWIEGLRDDVLRHILDLMKIIPISEEDKKAKLQLCSKYLEMFTQIKER
EKFFVDLSVDMLAGMREMLLANQAYYQALFRDGECFLHVVSLLNSDLDEGKGERLVLNVL
QTLTHLLANNDTSKAAFRALAGKGYQTLQSLLLDFCQWHSSESLLDALLDMLVDGKFDIK
ISPIIKNEDVIILYLIVLQKSSESLKHNGLEVFQQLLRDSISNRASCVRAGMLDFLLNWF
CQEDNDSVIFQIAQLIQAIGGHSISGKDIRKIFALLRSEKVGMRRHYGSVLLTSLLSMLH
EKGPTAFFDLNGIDSGIILKTPLQWPLNKGFSFSCWLRIENFPRNGTMGLFGFLTENGRG
SLAVISKEKLTYESINLKRQRSDLHVNLVRRRWHFLCITHSIGRAFSGGSLLRCYLDGGL
VSSERCRYAKISEPLTSCMVGAKLKMPNYEDSTLTFESIRDSCPFFGQIGPVYLFNDAIS
SEQVQSIYSLGPSYMYSFLDNETLPVSGDKMPSGILDAKDGLASRIIFGLNAQASVGRML
FNVSPIMSHAVDKNSFEATVIGGTQLCSRRMLQQIMYCVGGVSVLFPLITQWCNFENEVG
ESEKTPLMQSTRECMMGEVIELIASLLDENVANQQQMHIVSGFSVLGFLLQSVPPQQLNL
ETLSALKHLFNVVSNSGLAELLVEEAISSIFLNPLIWVCTVYKVQRELYMFLIQQFDNDP
RLLKSLCRLPRVLDIIHQFYCDNVKSRLYIGNNLLQHPVSKKVIGERPSKEEMHKIRLLL
LSLGEMSLRQNIAAGDMKALIAFFETSQDMTCIEDVLHMIIRAVSQKSLLASFLEQVNII
NGSQVFVNLLQREYESIRLLSLQFLGRLLVGLPSEKKGSRFFNLPMGRSKSISENYRKIR
MQPIFLAISDRLFSFPQTENLCATLFDVLLGGASPKQVLQRHSHLERVKSKGSSSHFLLP
QMLLLIFRYLSGCEDTDARIKIIRDILDLLDSNASNIEAFMEYGWNAWLTSSLKLGVLTD
KNVKLPNHGNSTMDELLVVRNLFSLVLCHYLHSVKGGWQQLEETVNFLVMHSEEGGNSYR
FFLRDIYEDVIQNLVDLSASDNIFISQPCRDNTLYLLKLIDEMLISEIDKELPLLGSESD
FHLDLEMECHKEYSSALKDVLIGEVDEQTSRKSQNLKQPVPCDDTIEEKWWNLYDNLWVV
ISKMNGKGPSSVLPKSSSFAGPSLGQRARGLVESLNIPAAEVAAVVVSGGMIGNALTPKP
NKNVDKAMVLRGERCPRIIYHLVILYLCKSSLEKSSRCVQQFTSLLPCLLTADDEQSKIR
LQLIIWVLLFVRSQYGMLDDGARFHLLSHLIRETVNIGKSMLATSLVSRDDTLDPNYNLK
DAGSIQNLIQKDRVLAAISDEANYTQISKIDRAQQVQELHIRIDENTLAESSSKQALEDE
IQNSLNSILSSDDSRRAEFQLTYEEEQQNVAEKWIHMFRSLIDERGPWSTKPFPNCIVTH
WKLDKTEDTWRRRPKLRQNYHFDENLCNPPSATASGIASPVNESNPGFVGNIPEQMKQLL
LKGIRKITDEGTFDSNETNTEISGPNTSIPPDHSDSHSSDLLKDNSDRKDVVHERRDTPS
SPETEASKVLVSIPCVLVTPKRKLAGHLAVMKNVLHFFAQFLVEGTGGSSVFRNFDALNN
SDLTKSVQKQRSMKWPASDMDLQKGITVGNVEVINGNGPVKLMRCVKRHRRWSLAKIKAV
HWTRYLLRYTAIEIFFSDSISPVFLNFASQKDAKDIGNLIVATRNEYLFPKGSGRDKNGP
INFVDRRVAQEMAETARESWRRRDITNFEYLMILNTLAGRSFNDLTQYPVFPWVLADYTS
EVLDYNRSSTFRDLSKPVGALDTKRFEVFEDRYRNFCDPDIPSFYYGSHYSSMGIVLYYL
LRLEPFTSLHRNLQGGKFDHADRLFQSIEGTFKNCLTNTSDVKELIPEFFYMPEFLLNSN
SYHLGVRQDGEPIGDVFLPPWSKGSPEEFIRRNREALESEYVSSNLHHWIDLVFGYKQRG
KPAVEAANIFYYLTYEGAVDLETTEDDLQRAAIEDQIANFGQTPIQMFRKKHPRRGPPIP
IARPLYFAPDSISLTSIVSNTSQSSSAILYVGLMDSNVILVNEGLNLSVKTWVSTQLQSG
GNFTFSGSQDYFFGVGSEMLSPRKIGIPVPEHVELGEQCFATMQAPSENFLISCGNWENS
FQVISLSDGRMVQSIRQHKDVVSCIAVTSDGSILATGSYDTTVMVWEVFRGKTEKRIRNS
QSELPRKNYVIIETPCHILCGHDDIITCLHVSHELDIIISGSKDGTCVFHTLREGRYVRS
IRHPSGSPISKLVVSQHGQIVIYADDDLSLHLYSINGKHLATSESNGRLNTIQLSRCGEF
LVGAGDQGQIVVRSINTLEVVKKYQGVGKVLTSLTVTPEECFLAGTKDGSLLVYSIENPQ
LRKTSHSKSTKSKT
Download sequence
Identical sequences G7J4K4
XP_003602889.2.50012 Medtr3g100060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]