SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7JK73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7JK73
Domain Number 1 Region: 58-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000275
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7JK73
Sequence length 372
Comment (tr|G7JK73|G7JK73_MEDTR) Uncharacterized protein {ECO:0000313|EMBL:AES90985.2, ECO:0000313|EnsemblPlants:AES90985} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_4g101970 OC=Trifolieae; Medicago.
Sequence
MVIGLLVTLQGHSMKSKKLQNYKELVLGRLQRHSKSICSLRIHHLSSQWFGLMFIAVFGC
RSGLSGSWRGFALEHKLDDGDALVFELVEATRFKMKRKKKKIRTHLKQQKKLRLQVIVNP
SKKTKKQKQAIVCETKESESYEESLPEGNIDKAFKQQRENPSRKTKSSHKKKYKRNRNYL
LLPTLGQKRKQKCKYLLREKCKKITEVSITLEPKGKAQVAAIKLSNKVRKSKEGKNECEI
DESTKTKQLLLEDNAVNTTDPNTNKKNEHVCDEDIELMKVKPDGETSINSLKLQLAQQLE
LQDLSTVRYFMAYSHRGDHFVNILLQTNLFATKVVDNSLELNARYTSSENVPLSDHILCI
ELSVFYHHYYYN
Download sequence
Identical sequences G7JK73
XP_003608788.2.50012 Medtr4g101970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]