SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7KXY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7KXY4
Domain Number 1 Region: 23-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000942
Family B3 DNA binding domain 0.012
Further Details:      
 
Weak hits

Sequence:  G7KXY4
Domain Number - Region: 123-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000161
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7KXY4
Sequence length 223
Comment (tr|G7KXY4|G7KXY4_MEDTR) Uncharacterized protein {ECO:0000313|EMBL:AES78149.2, ECO:0000313|EnsemblPlants:AES78149} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_7g025150 OC=Trifolieae; Medicago.
Sequence
manfitmyhnppidhfravklsiqdrvevqpefvekykddlqdpwnimnmdggmhqikfk
msmynptlkdgwdplqqyhhfpdnvdiifgyygnnlfkvimfrevfcatkipsfhsrsmy
peeviifdihisdndfntpikmlpdhfgtflqndfrslltlccddgtiyfvdiihygdyv
ddpnsgiqwndfilsnyivagqklrfkfdltttymchvfpidv
Download sequence
Identical sequences G7KXY4
XP_003621931.2.50012 Medtr7g025150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]