SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7MFL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G7MFL0
Domain Number - Region: 122-197
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0335
Family NadC C-terminal domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7MFL0
Sequence length 712
Comment (tr|G7MFL0|G7MFL0_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH15907.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_02072 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAKSPENSTLEEILGQYQRSLRERASRSIHQLKCALKEGDVTIGGDAPNLSFSTSVGNED
ARTAWPELQQSHAVNQLKDLLRRQADKESEVSPSRRKMSPLRSLEHEETNMPTMHNLVPI
INDQSQYIHHLEAEVKFCKEELSGLKNKIQAVVLENESLQQELKSQRQEETLREQTLLDA
SGNVQNSWITTGEDSGVGEAAKRPFSHDNADIGKAASAGEQLELEKLKLTYEEKYEIQES
QLKFLRKDLAEYQRTCEDLKEQLKHKEFLLAANTSNRVAGLCLKCAQHEAVLSQTHNNVH
MQTIERLMKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQC
DQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKERESMGSKMLILSQNIAQLEAQ
VEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKANMEKDEAEKEHREFRAK
TNRDLEIKDQEIEKLRIELGESKQHLEQEQQKAARAREECLRLTELLGESEHQLHLTRQE
KDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLKE
ECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHEIMKQ
RLRQLDKHSQATAQQLVQLLNKQNQLLLERQSLSEEVDRLRTQLPSMPQSDC
Download sequence
Identical sequences G7MFL0
ENSMMUP00000026290 9544.ENSMMUP00000026290 ENSMMUP00000026291 XP_001092411.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]