SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7MLM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7MLM6
Domain Number 1 Region: 107-217
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.24e-27
Family Canonical RBD 0.0000154
Further Details:      
 
Domain Number 2 Region: 18-105
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-25
Family Canonical RBD 0.00000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7MLM6
Sequence length 352
Comment (tr|G7MLM6|G7MLM6_MACMU) Heterogeneous nuclear ribonucleoproteins A2/B1 {ECO:0000313|EMBL:EHH17430.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_13841 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
QKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRS
RGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKE
DTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHN
AEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFG
DGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYN
DFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY
Download sequence
Identical sequences F1LNF1 F6VYB1 G5BD43 G7MLM6 G7P0P7
10116.ENSRNOP00000015152 9544.ENSMMUP00000004838 9796.ENSECAP00000001477 ENSMMUP00000004838 ENSMMUP00000004838 HGL_H00000354021-2 ENSRNOP00000015152 ENSECAP00000001477 ENSRNOP00000015152 ENSECAP00000001477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]