SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PJZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PJZ3
Domain Number 1 Region: 9-56
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.7e-21
Family Ribosomal protein L39e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7PJZ3
Sequence length 57
Comment (tr|G7PJZ3|G7PJZ3_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH66128.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_03048 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
LPPLLAMSSHKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences G7PJZ3
ENSMMUP00000036948 ENSMMUP00000040142 ENSMMUP00000036948 ENSMMUP00000040142 9544.ENSMMUP00000036948 9544.ENSMMUP00000040142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]