SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7VXU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7VXU8
Domain Number 1 Region: 211-404
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.18e-73
Family B3/B4 domain of PheRS, PheT 0.0000028
Further Details:      
 
Domain Number 2 Region: 478-706
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.04e-49
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00026
Further Details:      
 
Domain Number 3 Region: 37-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.25e-47
Family Myf domain 0.0027
Further Details:      
 
Domain Number 4 Region: 716-814
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.23e-32
Family Anticodon-binding domain of PheRS 0.00071
Further Details:      
 
Domain Number 5 Region: 414-486
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.84e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7VXU8
Sequence length 815
Comment (tr|G7VXU8|G7VXU8_PAETH) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome OX=985665 OS=Paenibacillus terrae (strain HPL-003). GN=HPL003_15550 OC=Paenibacillus.
Sequence
MKVSFDWLSEYVSLDQVSAEDLAEKITRSGIEIDEVEHRNKGITGVVVGYVKSKEKHPDA
DKLNVCIVDAGQEEDLQIVCGAKNVDAGQKVPVAVVGAKLPGDFQIKKAKLRGVVSMGMI
CSAKELGMNDKLLPKELQEGILVLPEDAEIGTPITKLLGLDDYVLDFDLTPNRSDCLSMH
GAAYEVSAILGRDISLADPAKDLVEVSDAAADHLSVKVDTPELCTHYAARYITGVKVGAS
PLWIQNRLMAAGVRPINNIVDITNYVMLEYGQPLHAFDADKLENGNIEVRLARAGETLVT
LDDQERKLEPHMLLITDGVKPIALAGVMGGSNSEVTDATVSIALESAKFDGGTVRKTSRQ
LGLRSEASLRFEKEVDPGAVVPAVNRAAALIQRYAGGTVHQGIVESASEKAESRIIKLSL
DKVNRYLGTELSLLEVKTIFGKLHFGCGDVEQGVLEVEVPTRRGDITIDVDLIEEVARLY
GYDNIPTTPIEGPTTPGALTASQSLRRSLRKLLAHGGWQETISYSFVHPESAGLFNALTE
GSHPVRLAMPMSEDRSVLRTSIIPQMLDTAVYNMNRKQENLAIFEIGTVFYTAEQTLTRQ
PQEVQVLSLLLTGVRREKQWNIGAEKVDFFDIKGALETVFGYFGLGANIRYVADQPQSYH
PGRSASVWLDVNGTSQRIGTIGQIHPELQQSYGLNDTYVAEIALQQVIEHANSHIQFREL
ARFPSVERDIALVVDKDVEAGELLRVIHAAGGELLQDARVFDVFTGSKLGEDKKSVAISL
TYRHWEHTLTDEEINAAHIPVVTSLEQTFGAELRK
Download sequence
Identical sequences G7VXU8
WP_014280577.1.37039 gi|374322952|ref|YP_005076081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]