SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8A2Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8A2Z6
Domain Number 1 Region: 11-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-21
Family B3 DNA binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  G8A2Z6
Domain Number - Region: 187-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0373
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8A2Z6
Sequence length 251
Comment (tr|G8A2Z6|G8A2Z6_MEDTR) Plant-specific B3-DNA-binding domain protein {ECO:0000313|EMBL:AES70702.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_3g061330 OC=Trifolieae; Medicago.
Sequence
marrnstlpirffkiilqtnlhriqipnkftrrygvhlsnpvlikppdgtkwkvywkkin
geiwfekgwkyftenyslghgslvvfeykrtskfdvhifgrnaveidysscdsddendnv
dhsdddesveildewlnwkkakqrspfvsprphkkvrgddekttkrtssinwpkdvraqk
vaqnfisnnpfftilikpnhiadsqlfvpldlkgiienkeknvllqigkkswnvkllrys
eilngrrlsag
Download sequence
Identical sequences G8A2Z6
Medtr3g061330.1 XP_003600451.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]