SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8LTL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LTL7
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily Phase 1 flagellin 6.28e-93
Family Phase 1 flagellin 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8LTL7
Sequence length 272
Comment (tr|G8LTL7|G8LTL7_CLOCD) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_4093 OC=Ruminiclostridium.
Sequence
MRINNNLMAMNAHRQLKINSANQEKSLEKLSSGYRINRAGDDAAGLSISEKMRAQIRGLQ
KASSNAQDGISLIQTAEGALTETHEILQRMRELAVQAANDTNVDKDRSAIKLELNELSAE
ITRIAEKTQFNTQTLLAGGFSSKVIQIGANKGETLEIGIEAMDADTLGVGTSVMLVGTSS
EAQDTIEAIDNAINTVSSERAKLGAKQNRLEHTIRNLDTSAENLQASESRIRDVDMAKEM
MNFTKNNILNQAATAMLAQANMVPQGVLQLLQ
Download sequence
Identical sequences G8LTL7
gi|374298260|ref|YP_005048451.1| gi|374298261|ref|YP_005048452.1| WP_014257025.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]