SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8N3E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8N3E0
Domain Number 1 Region: 3-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.55e-50
Family Phosphoribulokinase/pantothenate kinase 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8N3E0
Sequence length 211
Comment (tr|G8N3E0|G8N3E0_GEOTH) Uridine monophosphokinase {ECO:0000256|HAMAP-Rule:MF_00551} KW=Complete proteome OX=1111068 OS=Geobacillus thermoleovorans CCB_US3_UF5. GN=GTCCBUS3UF5_28710 OC=Geobacillus thermoleovorans group.
Sequence
MGKKPVVIGVAGGSGSGKTSVARAIYDHFGDRSILVLEQDFYYKDQSHLPFEERLKTNYD
HPLAFDNDLLIEHIHKLLRYEPIDKPVYDYTLHTRSSDVIRVEPKDVIIVEGILVLEDER
LRNLMDIKVYVDTDPDIRIIRRLIRDIKERGRTFDSVIEQYLSVVRPMHNQFVEPTKRYA
DVIIPEGGQNVVAIDLMVAKIRTVLEQKAVL
Download sequence
Identical sequences A0A063YLA8 A0A098L1A5 A0A1C3D6K4 A0A1Q5T9X9 A0A1V4PD48 A0A1V9BUF8 G8N3E0 I0IV92 I0IV93 I0IV94 L7ZUF8 Q5KWV3 T0Q8C5 U2Y0U9 V6V7L2
235909.GK2548 WP_011232026.1.100150 WP_011232026.1.17728 WP_011232026.1.19233 WP_011232026.1.2219 WP_011232026.1.22479 WP_011232026.1.25743 WP_011232026.1.3446 WP_011232026.1.45808 WP_011232026.1.60903 WP_011232026.1.6497 WP_011232026.1.70239 WP_011232026.1.77642 WP_011232026.1.78869 WP_011232026.1.8599 WP_011232026.1.90668 WP_011232026.1.91533 WP_011232026.1.93593 gi|375009641|ref|YP_004983274.1| gi|448238826|ref|YP_007402884.1| gi|56421083|ref|YP_148401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]