SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8NTX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8NTX8
Domain Number 1 Region: 7-363
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 7.32e-86
Family Homocysteine S-methyltransferase 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8NTX8
Sequence length 366
Comment (tr|G8NTX8|G8NTX8_GRAMM) Methionine synthase {ECO:0000313|EMBL:AEU37534.1} KW=Complete proteome; Reference proteome OX=682795 OS=Granulicella mallensis (strain ATCC BAA-1857 / DSM 23137 / MP5ACTX8). GN=AciX8_3233 OC=Granulicella.
Sequence
MTKAHQHPLEKILESRIAIIDGAMGTTIRTYGMTEADIRGERFKDSKKDLLNNGDLFSLT
QPKMICDIHRRFLEAGADIIETNTFGATGITQSEFFVDDPREHGGRKDPEFYQKIIEDKF
LNDLAWEINEQSARQCREWADRTANETGRQRFVAGAIGPLTVSLSNSPDADDSGFRVVTF
DQVKAAYVQQVRALIAGGSDLLLVETIFDSLNAKAALVAIREVFDQDGLTSNNKELPVMI
SAAVGRGGETLISAQTTEAFWNAVQHVKPLSVGLNCSLGPDLMYPFLEELSEKADVAISC
YPNAGLPNPLSETGFDLGPQDMARYLGDFARGGLINIAGGCCGNTPEHIAAIAKALDGKA
PRELGA
Download sequence
Identical sequences G8NTX8
WP_014266408.1.98070 gi|374312134|ref|YP_005058564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]