SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8PLS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8PLS8
Domain Number 1 Region: 91-227
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.18e-32
Family GntR ligand-binding domain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.32e-20
Family GntR-like transcriptional regulators 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8PLS8
Sequence length 248
Comment (tr|G8PLS8|G8PLS8_PSEUV) Transcriptional regulatory protein {ECO:0000313|EMBL:AEV39348.1} KW=Complete proteome; Reference proteome OX=911045 OS=Pseudovibrio sp. (strain FO-BEG1). GN=PSE_4846 OC=Rhodobacteraceae; Pseudovibrio.
Sequence
MDGQRRRYQEVAEVLRKELSNGTFKVGDRLRPERQIAEEMNVSRSLLREAMIMLEIEGLI
DVRKGSGTYVVRLPDTDQVTPTSNLEDIGPFELLQARQLMESNIAAFAASMVTKADILRM
RDALEREREDLAKGSGGYEADEEFHLLIAEATQNSVLVDMVRNLWQQRTRSKMWDKLHER
IFDNTYREEWLNDHQDILDALQRRDPQAAKQAMWQHLENVKKRLMELSDVDDPAFDAYLF
QQDPLTPA
Download sequence
Identical sequences G8PLS8
WP_014287067.1.37980 gi|374333186|ref|YP_005083370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]