SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8QI04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8QI04
Domain Number 1 Region: 120-276
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.23e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 407-548
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.72e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00095
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.11e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.024
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8QI04
Sequence length 558
Comment (tr|G8QI04|G8QI04_DECSP) Sulfite reductase, beta subunit (Hemoprotein) {ECO:0000313|EMBL:AEV26358.1} KW=Complete proteome; Reference proteome OX=640081 OS=oryzae). GN=Dsui_1986 OC=Rhodocyclaceae; Azospira.
Sequence
MYRYDNYDHALVQERVAQFRDQVRRWKAGELSDEEFRPLRLQNGLYIQRHAPMFRVAVPY
GMLSSAQLRRLAKIARDYDKGYGHFTTRHNLQFNWIPLERVPDALAELAEVEMHAIQTSG
NCIRNVTTDQFAGVAADEILDPRPLCELLRQWSTFHPEFAFLPRKFKIAVNGALEDRALT
WFHDIGLHIRKNEAGEVGFRVIVGGGLGRTPIRGQVVREFLPWQDILTYNEAILRVYNRY
GRRDNAYKARIKILVQALGVEKFAEQVEAEWAHLKGGPATITQAEYDRVAAFFNPPAYAQ
LPAIDDGFVQAQAEQPAFARWVERNVRPHRVPGYAAVTLSLKKPGTAPGDVSDVQMDRVA
DLADRYSFGEVRVTHEQNLVLADVRQDELQALWQDAKAAALATPNIGLITDMICCPGGDF
CDLANAKSIPIANAIQAKFEDLDYLYDIGDIELNISGCMNSCGHHHVGHIGVLGVDKGNE
EWYQITLGGRQGNNAHLGKVIGPSFPADEVAGVVEKLIRVYLDNRHEDELFIDTLDRLGV
EPFKDKVYGDRLKGKKAA
Download sequence
Identical sequences G8QI04
gi|372488634|ref|YP_005028199.1| WP_014237056.1.43509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]