SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8S6X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G8S6X9
Domain Number - Region: 7-46
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0366
Family Achaeal helicase C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8S6X9
Sequence length 76
Comment (tr|G8S6X9|G8S6X9_ACTS5) Uncharacterized protein {ECO:0000313|EMBL:AEV85008.1} KW=Complete proteome; Reference proteome OX=134676 OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110). GN=ACPL_4113 OC=Actinoplanes.
Sequence
MRDDRQATETTETDARSTLLDLVARVPFGVQAAVLAGVLVAGVGVADTGRTEARAAEVVT
AFGIASTTCCPPPDPR
Download sequence
Identical sequences G8S6X9
gi|386849063|ref|YP_006267076.1| WP_014691080.1.1565 WP_014691080.1.34629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]