SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8S7U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8S7U1
Domain Number 1 Region: 212-326
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-32
Family NlpC/P60 0.0024
Further Details:      
 
Weak hits

Sequence:  G8S7U1
Domain Number - Region: 34-236
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0107
Family Phase 1 flagellin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8S7U1
Sequence length 330
Comment (tr|G8S7U1|G8S7U1_ACTS5) YdhO-like uncharacterized protein {ECO:0000313|EMBL:AEV81229.1} KW=Complete proteome; Reference proteome OX=134676 OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110). GN=ACPL_332 OC=Actinoplanes.
Sequence
MLATRHAAALRRRGWTVALLAAVLSLGMTAPARANPSPQQIEKQLDQQWNQLEPTIEQYN
QVHTQLQTSRSQQQKLTKQLQPLQARVDAAMSGVGQLASRAYMQGGDIALSSLLISGNPA
DLTDKLTYLDVMASSRRSQVAGVITLRDKYASDKKQLDTVTASLAARDADLAAKKNTIQK
KINDLQQLRVKAYGAGGGASGNLRTGACPATYTNDPGGKAAAKACSLIGKPYIWADAGPD
GYDCSGLTLAAWATVGVSLRHYTKWQWEDTKPVSRADLKPGDLVFWYSDLHHMGMYVGNN
TVVHAPHTGDFVRMAGLDAVGPVAGFRRPS
Download sequence
Identical sequences G8S7U1
WP_014687308.1.1565 WP_014687308.1.34629 gi|386845284|ref|YP_006263297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]