SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8TPB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G8TPB2
Domain Number - Region: 38-100
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0051
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 180-207
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8TPB2
Sequence length 262
Comment (tr|G8TPB2|G8TPB2_NIAKG) PASTA domain containing protein {ECO:0000313|EMBL:AEV96718.1} KW=Complete proteome; Reference proteome OX=700598 OS=Niastella koreensis (strain DSM 17620 / KACC 11465 / GR20-10). GN=Niako_0320 OC=Chitinophagaceae; Niastella.
Sequence
MTGKPLWVHLLAALGLILLLIVVFLQSLHWITRHDKTLTIPAVTGKPYAEARKILESKGF
EVELQDSIYNDTAKPLSVLRQFPDAEAVVKVNRTVYLTINKSIAPLIEMPNLEGLSFRSA
EISLSQYLLKLGDTSYRMDFAKNSVLEQQFNGDRIKAGTKIPQGSKISLILGSGLGHEDF
SVPDLVGLTYNDAKVLLESNGLNVGTVIPSIDSSAFVGRQSPEHNTPDGRINRIRQGQSV
DLWLQRDKPVKATVPVVPPPQP
Download sequence
Identical sequences G8TPB2
gi|375143681|ref|YP_005006122.1| WP_014216632.1.59341 WP_014216632.1.81374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]