SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8XB76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8XB76
Domain Number 1 Region: 6-205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.06e-54
Family PP-loop ATPase 0.0000169
Further Details:      
 
Domain Number 2 Region: 344-431
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000759
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.039
Further Details:      
 
Weak hits

Sequence:  G8XB76
Domain Number - Region: 262-300
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0265
Family Myb/SANT domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8XB76
Sequence length 435
Comment (tr|G8XB76|G8XB76_FLACA) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=1041826 OS=Flavobacterium columnare (strain ATCC 49512 / CIP 103533 / TG 44/87). GN=FCOL_06115 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MLIQLQNHINQNLPFLNDKKLLLAVSGGIDSMILLNLFSKLNLQIAIAHCNFQLRGDESN
KDEEFVKFESQKLKVESFIKNFETQIYANDNKLSIQQAARELRYNWFYELLNTQGFDHLL
TAHHLDDSLETFLINFTRGTGIEGLTGIPQINDKIIRPLLIFSREEIEKYAAENNIQWRE
DASNASDKYFRNKIRHHVVPILKELNTNLLSSFQNTLKNLKQTESLASHSIYNKLEEIAI
KKEDDIYFDVVKLQTLPNYKAYLYEWLKSYGFHDWDAIYDLVENQSGKQILSDHYRLIKD
RNILILTKKQTSLTLEFFISKETKYIENPIKLRFCNSGYNTIPTKSSIFVNKETLKFPLK
LRKWQKGDYFYPSGMKGKKKISKYFKDEKFSLVDKEDTWLLLSDDKIVWVINHRADNRFI
AHSNTKNILNIIFTE
Download sequence
Identical sequences G8XB76
WP_014165323.1.70420 gi|365960270|ref|YP_004941837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]