SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G9NGR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9NGR7
Domain Number 1 Region: 3-364
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.67e-107
Family IF2B-like 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G9NGR7
Sequence length 386
Comment (tr|G9NGR7|G9NGR7_HYPAI) Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein {ECO:0000256|HAMAP-Rule:MF_03119} KW=Complete proteome; Reference proteome OX=452589 OS=atroviride). GN=TRIATDRAFT_297230 OC=Trichoderma.
Sequence
MSALEAVKYQRGKLEVLDQLRLPHEFHYDPVSTRQEAFDSIATMRVRGAPAIAIVASLGL
AVELHNNPIAAASDSELITRIDEALDYLKESRPTAVDLSNAIAQLKAVIRTTEGKGQTAI
TESFIEEAERIFKKDLQNNLSIGDFGTQWLQSQAGASAEQQISVLTHCNTGALATSGHGT
ALGIIRTLHYKSFLKHAFCTETRPYNQGSRLTAFELVHEGIPSTLITDSMAAALFRTKKT
ENNIAAVIVGADRVVRNGDTANKIGTYQLAVLAKHHGIKFIVAAPTTSIDLDTKTGDGIK
IEERKKEELTQITGAVVGSDGQVDKESKVRVATADQRIGVWNPAFDVTPAEFIDVVVTEK
GAVEKGPDGTFDFSKILPERWAKVAN
Download sequence
Identical sequences G9NGR7
XP_013948634.1.20613 jgi|Triat1|128718|estExt_fgenesh1_pm.C_80144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]