SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G9NJH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9NJH8
Domain Number 1 Region: 4-367
Classification Level Classification E-value
Superfamily Translation proteins 3e-109
Family Ribosomal protein L3 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9NJH8
Sequence length 391
Comment (tr|G9NJH8|G9NJH8_HYPAI) Uncharacterized protein {ECO:0000313|EMBL:EHK49051.1} KW=Complete proteome; Reference proteome OX=452589 OS=atroviride). GN=TRIATDRAFT_297774 OC=Trichoderma.
Sequence
MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKDDAKKPVHLTATMGYKAGMTTIVRDL
DRPGAKANKKEVVEAVSIIDTPPMIVVGLVGYIETPRGLRSLTTVWAEHLSDEVKRRFYK
NWYKSKKKAFTKYAKKHSDNSGSTITRELERIKKYCTVVRVLAHTQIRKTPLKQKKAHLM
EIQINGGSVAEKVDFGKDLFEKPVSIDSIFEQDEVIDVIAVTKGHGFSGVTSRWGTKKLP
RKTHKGLRKVACIGAWHPSHVQWTVARAGQEGYHHRTSVNHKVYRIGKGDAEDSASTETD
VTKKKITPLGGFVRYGEVNNDFVMVKGSIPGTKKRVVTLRKSMWTHTSRKALEKISLKWI
DTSSEFGHGAFQTPAEKKQFQGTLKKDLASA
Download sequence
Identical sequences G9NJH8
jgi|Triat1|156281|estExt_Genewise1Plus.C_120388 XP_013947211.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]