SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0GNC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0GNC2
Domain Number 1 Region: 101-205
Classification Level Classification E-value
Superfamily TPR-like 3.4e-32
Family Tetratricopeptide repeat (TPR) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0GNC2
Sequence length 346
Comment (tr|H0GNC2|H0GNC2_SACCK) Sgt2p {ECO:0000313|EMBL:EHN04781.1} KW=Complete proteome OX=1095631 OS=(Yeast). GN=VIN7_4450 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF
KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL
AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK
YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA
SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE
GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ
Download sequence
Identical sequences A0A0L8VHJ4 A0A250WB02 A6ZNL2 B3LJ62 C7GJU6 C8ZHX0 E7M068 E7NNB5 E7Q966 G2WMN7 H0GNC2 N1NY70 Q12118
YOR007C YOR007C YOR007C YOR007C YOR007C YOR007C NP_014649.1.97178 YOR007C YOR007C YOR007C YOR007C YOR007C 4932.YOR007C SCRT_01409 YOR007C YOR007C YOR007C tr|A6ZNL2|A6ZNL2_YEAS7 YOR007C YOR007C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]