SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0V4U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0V4U9
Domain Number 1 Region: 131-454
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.41e-64
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000239
Further Details:      
 
Domain Number 2 Region: 477-607
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.09e-29
Family Ricin B-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0V4U9
Sequence length 608
Comment (tr|H0V4U9|H0V4U9_CAVPO) Protein-UDP acetylgalactosaminyltransferase {ECO:0000256|RuleBase:RU361242} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=GALNT11 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPFKNVPIKGSGPHGPFPKKFYPRFT
RGPSRMLDPQFKPNRIDDVIDNQVEDPEKDHQKFSSELGMIFNERDQELRDLGYQKHAFN
VLISNRLGYHRDVPDTRNAACKEQSYPADLPVASVVICFYNEAFSALLRTVHSVLDRTPA
YLLHEIILVDDDSDFDDLKGELDEYVQKSLPTKIKVIRNAKREGLIRGRMIGAAHATGEV
LVFLDSHCEVNEMWLQPLLATIRGDPHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHF
KWDLVPLSELGGEDGATAPIKSPTMAGGLFAMNRQYFNELGQYDSGMDIWGGENLEISFR
IWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKDQYFSLRPD
LKTKSYGNISERVELRKRLGCRSFKWYLDNIYPEMQVQGPNAKAQQPVFVNRGPKRPRVL
RRGRLYHFQTNKCLVAQGRPSQKGSLVVLKACDYRDPAQVWIYNEEHELVLNNLLCLDVS
ETRSSDPPRLMKCHGSGGSQQWTFGKNNWLYQVSVGQCLTVVDPLGQKGSVAMAICHGFP
SQQWHLEG
Download sequence
Identical sequences H0V4U9
10141.ENSCPOP00000004654 ENSCPOP00000004654 XP_003469821.1.53824 ENSCPOP00000004654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]