SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0V579 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0V579
Domain Number 1 Region: 683-829
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1010-1108
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-30
Family Ras-binding domain, RBD 0.0008
Further Details:      
 
Domain Number 3 Region: 218-369
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-21
Family Phosphotyrosine-binding domain (PTB) 0.0091
Further Details:      
 
Domain Number 4 Region: 12-97
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-19
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 5 Region: 955-1024
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000599
Family Ras-binding domain, RBD 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0V579
Sequence length 1424
Comment (tr|H0V579|H0V579_CAVPO) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSCPOP00000004797} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=RGS12 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MYRAGEPVKRPPLGPVPPRLRSVEVARGRAGYGFTLAGQAPCVLSGVIRGSPADFVGLRA
GDQIFTINEINVKKASHEDVVKLIGKCSGVLRLVIGEGAGHPEACSSDDEGGLCEGKGWL
RPKLDSKALGINRAERVVEEMQSGGIFSMIFENPSLCMSTPEPSQGKQRSLSESASVRLE
GSPNAVQTGLLSKEELVRVIHDDSVFSAGPENLDSFALDASILNVAMVVGYLGSIELPST
SCNLESDSLQAIRGCMRRLRAEQKIHSLVTMKVMHDRVLLCSDKACVVAEYPAEKLAFSA
VCPDDRRFFGLVTMQTNDDGSLAQGEEGALRTSCHVFMVDPDLFHHKIHQGIARRFGFMC
TADPDTSGCLEFPASSLPVLQFISILYRDMGEFIEGVRARAFLDGDADAHQNNSTSSNSD
SGIGNFNQEEKSNRVLVVDLGGGLSRHGPGSSASWEGAGARSSQSWAASWSRSFCHSPEG
CASFEAGPQADRLRDLSKHLGPASHTEGTPASLWSSVPPSKRGSASTSCGLSQRWLPVHV
LQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFMQAPLSAQKRDW
ARKAFGMQNLFGPSRNVRRTKEDKKGSKFGRGIGLAQTSQRSSARRSFRRSKRFSITRSL
DDLEVELTGADLKDCVSSNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGIRY
FSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSHRAREIFSKFLCSKATTPVNIDSQA
QLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRALPDAQQVP
SSPASKHSIGSDHSSTSTPKKLSGKSKSGRSLNEDAGDEDSEKKRKGAFFSWSRSRSTGR
SQKKKEPGDHGQDTLPTNGGLCRRRESQGSVSSAGSLDLPEACRTLVPEKDKAVKHCCIY
LPDGATCVVAVKSGFSIKEILAGLCERHGINGAAVDLFLVGGDKPLVLHQDSSILASRDL
RLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSGEKEPLDL
GAPISSLDGQRVVLEERDPARGRAPTDKQKGALAKPSAAASSRPRDRSATGEERTLGKSN
SIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRG
LLTKEDLVLPEFLRLPPGSTKLPLCTLAAGKGFSKRPETTGHSREKASLPSDSPATSPGS
TQSTSSAQSPGSAQSPGSAHSPSGPRGASPLGQKVQEGPTQVWRRRQSQEVEDGGIQTED
ESRADLTLVGEGDISSPNSTLLPPPPSPQDAPGPLRPGGRARGSQGLPVNRIFDVDLAAG
MAPRVWPGPRRARPMRPPASDCPGQSPSPGEPKAKLSTHHATFV
Download sequence
Identical sequences H0V579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]