SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0VBL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VBL6
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 20-280
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-54
Family YWTD domain 0.0000017
Further Details:      
 
Domain Number 3 Region: 331-561
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-51
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 934-1189
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000886
Further Details:      
 
Domain Number 5 Region: 1320-1356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1241-1281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 890-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.023
Further Details:      
 
Domain Number 9 Region: 587-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 10 Region: 285-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000742
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1199-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000986
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0VBL6
Sequence length 1600
Comment (tr|H0VBL6|H0VBL6_CAVPO) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=LRP5 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
RALCPTCLILMVCFHPSASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFS
KGTVYWTDVSEEAIKQTYLNQTGVATQNVIVSGLVSPDGLACDWVGKKLYWTDSETNRIE
VANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSE
IYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWT
DWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSQERQPSFHTQCEEDNGGCSHLCLLS
PREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIR
HAIAIDYDPLEGHVYWTDDEVRAIRRARLDGSGAQTLVNTEINDPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGRE
RHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINMDGTKRRTLLEDKLPHIFGFTL
LGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVIGTNPCADGNGGCS
HLCFFTPHATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTG
VKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLY
WADTGTNRIEVARLDGQFRQVLVWKDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDG
TNCMTLVNKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQ
YSDYIYWTDWNLHSIERADKTSGQNRTLVQGHLDFVMDILVFHSSRQDGLNDCVHNNGQC
GQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKCAISRMIPDDQHSPDLILPL
HGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGSQAFVLTSLGQSPDRQPHDLSIDIYS
RTLFWTCEATNTINVHRLDGDAMGVVLRGDRDRPRAITVNAERGYLYFTNMQDRAPKIER
ASLDGTEREVLFTTGLIRPVALVVDNSLGKLFWVDADLKRIESCDLSGANRLTLEDASIV
QPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTGIHAVEEVNLEEFSAH
PCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIP
GAWRCDGFPECDDQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEVDCQDRSDEADCDAV
CLPNQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEITKPPSDETPAHSSAIGPVIGIIL
SLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFPGISCSK
SMMSSVSLMGGRSGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDM
FYSSNIPATTRPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPP
PPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences H0VBL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]