SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0VKJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VKJ1
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 6.02e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  H0VKJ1
Domain Number - Region: 208-326
Classification Level Classification E-value
Superfamily ALDH-like 0.0134
Family ALDH-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0VKJ1
Sequence length 356
Comment (tr|H0VKJ1|H0VKJ1_CAVPO) Stomatin like 2 {ECO:0000313|Ensembl:ENSCPOP00000010827} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=STOML2 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MLARAARGTGALVLRGFVQASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADYWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRIMAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTVLLPS
NPGDVTSMVAQAMGVYGALTKAQMPRAQNSVSSGSSRDVKGTNANLDEEIDRVKLS
Download sequence
Identical sequences H0VKJ1
10141.ENSCPOP00000010827 XP_003470897.1.53824 ENSCPOP00000010827 ENSCPOP00000010827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]