SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0W0T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0W0T9
Domain Number 1 Region: 29-156
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-32
Family C-type lectin domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0W0T9
Sequence length 157
Comment (tr|H0W0T9|H0W0T9_CAVPO) Regenerating family member 4 {ECO:0000313|Ensembl:ENSCPOP00000016577} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=REG4 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MASKGWCFFLLLSWVARPKAHGDIWRPSCAPGWFYYKSNCYGYFWRPRTWFDAEIECQSY
GYGTHLASVLSHKEASVISKYISGYQRNQPVWIGLHDPQQKELWQWLDGTPYLKGFLNNG
TSGEHKHCAEMSYKKKFLAWNKNDCNKLQHFLCKYQP
Download sequence
Identical sequences H0W0T9
XP_003479324.1.53824 ENSCPOP00000016577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]