SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0WIZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WIZ1
Domain Number 1 Region: 920-1056,1114-1180
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.19e-39
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000111
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000942
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WIZ1
Sequence length 1180
Comment (tr|H0WIZ1|H0WIZ1_OTOGA) Proteoglycan 4 {ECO:0000313|Ensembl:ENSOGAP00000001430} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PRG4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MEWKMLPIYLLLLLSIFLVQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTAELSCKGRCFESFERGRECDCDAQCKKYGKCCPDYESFCEEVHKSTPPTSSKTAP
RPPEARPNIKSTTKRSPKSPDKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSSSTIR
KVKSSKNSAANRELQKKPKVKDNKKKRTPKKTPPPEPPAVDEPGSGLDNEDFKPTPTPDA
PTTKSNKVTTSPKSTTAKPTNPKPSLPPNADASEETSLTAKKETTSETKETSITNKQTSA
STKKETTSAKETRNTEKTSAKDLAPTTQVPGKPTPKAETTTKAPATTTPKEPAPTTTKKP
APTTPKEPAPTTTKEPAPTPKEPAPTTTREPPPTTTKEAEPTTPKEPSPTTPKEPAPTTT
REPPPTTTKEPEPTTPKEPAPTTPKEPELTTPKEPAPTTTKEAEPTTPKEPELTSPKEPE
PTTPKKPPPTTPKEPAPTTPEEPAPTTTKEPAPTTPKELAPTTPKEQPSTTPEKPAPTSP
KEPAPTTTKEPEPTTPKEQPSTTPEKPAPTTPKEPAPTTPKEPAPTSPKEPVPTSPKDPA
STTPKEPAPTTPQDPAPTTTREPASTTPETPAPTTSSPSTTTEPPTIPENPPESTPEFPA
EPTPKDLENSPTEPAEPTSKTPEVSKSEMTTPTKDKTTEKDTRPTPEATTAAPKMTTEET
AATKEETTASQTTSTTPRVTSHAAQDATWLRATTPKATTLAPKVTTTAKETTSIAEETAQ
TPEQTAKPTDTPANSKATTPKPRKPTKAPKKPTSTRKPRPRKPKTTPAPPETTTAMPAVN
PISRAETTLQTTVSPKQTPNSLQVEENPRSEDAQGPGGEKPHLIPRPPVLIPIVIPGSDY
IVRRPNQGISFDPMLSDETNLCNGKPVDGLTTLRNGTLVAFRGHYFWMLNPFTPPSPARR
ITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDVKDSGYPKQIVKGFNGLTGKIV
AALSIAKFKNRPESVYFFKRGGSVQQYTYKQEPVRKCPGRRPPINYSVYGDTTQVRRRRF
ERAIGPSQTHTITIHYTPVRVAYQDKGFLHNELKVSTLWRGLPNVVTSAISLPNIRKPDG
YDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences H0WIZ1
ENSOGAP00000001430 ENSOGAP00000001430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]